PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00137-abinit-gene-0.5-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family Nin-like
Protein Properties Length: 249aa    MW: 29016.8 Da    PI: 5.2625
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00137-abinit-gene-0.5-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.58.3e-26141190352
                                                RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                                           + ++l++++k+F+ pi++AAke++v+lTvLK++CR+++I+RWPhRkiksl
  augustus_masked-scaffold00137-abinit-gene-0.5-mRNA-1 141 ALLELDEIQKHFDVPITKAAKEMNVGLTVLKKRCRELNIMRWPHRKIKSL 190
                                                           56899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.279130211IPR003035RWP-RK domain
PfamPF020423.4E-23143190IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGSIQHDIPI KIDNPHEFDW VYQEDHSKKN FELPALDSYF DELSDSFPLP YSYSKQLPFT  60
EFQDFEDFPN DFFSMEQVQD FASHFDMDHV VLDQSPVNPI TEFAPSGSEL SESSVISQSE  120
YASSGKSEEE KGTGSRRKRT ALLELDEIQK HFDVPITKAA KEMNVGLTVL KKRCRELNIM  180
RWPHRKIKSL NSLIKNIQDL GLKREADILE DHKRLLEILP DTELTEEIKR LRQACFKAKY  240
KKKRMAIQD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039079.12e-67RWP-RK domain-containing protein, putative
TrEMBLA0A061G1542e-67A0A061G154_THECC; RWP-RK domain-containing protein, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-42RWP-RK domain-containing protein